Lineage for d1nekb2 (1nek B:1-106)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2931196Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2933780Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families) (S)
  5. 2933988Family d.15.4.2: 2Fe-2S ferredoxin domains from multidomain proteins [54312] (14 proteins)
  6. 2934092Protein Succinate dehydogenase iron-sulfur protein, N-terminal domain [82586] (3 species)
  7. 2934103Species Escherichia coli [TaxId:562] [82587] (6 PDB entries)
  8. 2934110Domain d1nekb2: 1nek B:1-106 [80430]
    Other proteins in same PDB: d1neka1, d1neka2, d1neka3, d1nekb1, d1nekc_, d1nekd_
    complexed with ca, cdn, eph, f3s, fad, fes, hem, oaa, sf4, uq2

Details for d1nekb2

PDB Entry: 1nek (more details), 2.6 Å

PDB Description: Complex II (Succinate Dehydrogenase) From E. Coli with ubiquinone bound
PDB Compounds: (B:) Succinate dehydrogenase iron-sulfur protein

SCOPe Domain Sequences for d1nekb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nekb2 d.15.4.2 (B:1-106) Succinate dehydogenase iron-sulfur protein, N-terminal domain {Escherichia coli [TaxId: 562]}
mrlefsiyrynpdvddaprmqdytleadegrdmmlldaliqlkekdpslsfrrscregvc
gsdglnmngknglacitpisalnqpgkkivirplpglpvirdlvvd

SCOPe Domain Coordinates for d1nekb2:

Click to download the PDB-style file with coordinates for d1nekb2.
(The format of our PDB-style files is described here.)

Timeline for d1nekb2:

2934110
d1nekb2 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d1nekb1