Lineage for d1ndra1 (1ndr A:11-166)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 791145Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 791146Superfamily b.6.1: Cupredoxins [49503] (7 families) (S)
    contains copper-binding site
  5. 791546Family b.6.1.3: Multidomain cupredoxins [49550] (7 proteins)
  6. 791669Protein Nitrite reductase, NIR [49551] (5 species)
    consists of two domains of this fold
  7. 791890Species Alcaligenes xylosoxidans [TaxId:85698] [49554] (31 PDB entries)
    Uniprot O68601 25-360
    Uniprot O68601 26-359
    Uniprot O68601
    Uniprot O68601 25-360 ! Uniprot O68601 26-359 ! Uniprot O68601
  8. 791987Domain d1ndra1: 1ndr A:11-166 [23118]
    CA-atoms only

Details for d1ndra1

PDB Entry: 1ndr (more details), 3 Å

PDB Description: crystallographic structure of a blue copper nitrite reductase from alcaligenes xylosoxidans
PDB Compounds: (A:) nitrite reductase

SCOP Domain Sequences for d1ndra1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ndra1 b.6.1.3 (A:11-166) Nitrite reductase, NIR {Alcaligenes xylosoxidans [TaxId: 85698]}
glprvavdlvapplvhphsqvaagapkvvqfrmsieekkmvadddgttaqamtfngsvpg
ptlvvhegdyieltlvnpatnsmphnvdfhaatgalggagltqvvpgqeavlrfkadrsg
tfvyhcapagmvpwhvvsgmngalmvlprdglrdaa

SCOP Domain Coordinates for d1ndra1:

Click to download the PDB-style file with coordinates for d1ndra1.
(The format of our PDB-style files is described here.)

Timeline for d1ndra1:

791987
d1ndra1 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d1ndra2