Lineage for d1ndha2 (1ndh A:126-272)
- Root: SCOPe 2.07
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.25: Ferredoxin reductase-like, C-terminal NADP-linked domain [52342] (1 superfamily)
3 layers, a/b/a; parallel beta-sheet of 5 strands, order 32145Superfamily c.25.1: Ferredoxin reductase-like, C-terminal NADP-linked domain [52343] (6 families) 
binds NADP differently than classical Rossmann-fold
N-terminal FAD-linked domain contains (6,10) barrelFamily c.25.1.1: Reductases [52344] (5 proteins) Protein cytochrome b5 reductase [52357] (3 species) Species Pig (Sus scrofa), liver [TaxId:9823] [52358] (9 PDB entries) 
Domain d1ndha2: 1ndh A:126-272 [31552]
Other proteins in same PDB: d1ndha1
complexed with fad
Details for d1ndha2
PDB Entry: 1ndh (more details), 2.1 Å
PDB Description: crystal structure of nadh-cytochrome b5 reductase from pig liver at 2.4 angstroms resolution
PDB Compounds: (A:) cytochrome b5 reductaseSCOPe Domain Sequences for d1ndha2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ndha2 c.25.1.1 (A:126-272) cytochrome b5 reductase {Pig (Sus scrofa), liver [TaxId: 9823]}
gkfairpdkksspviktvksvgmiaggtgitpmlqviraimkdpddhtvchllfanqtek
dillrpeleelrnehsarfklwytvdrapeawdysqgfvneemirdhlpppeeeplvlmc
gpppmiqyaclpnlervghpkercfaf
SCOPe Domain Coordinates for d1ndha2:
Click to download the PDB-style file with coordinates for d1ndha2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ndha2:
- d1ndha2 first appeared (with stable ids) in SCOP 1.55, called d1ndh_2
- d1ndha2 appears in SCOPe 2.06
- d1ndha2 appears in the current release, SCOPe 2.08
View in 3D
