![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
![]() | Superfamily d.15.1: Ubiquitin-like [54236] (9 families) ![]() |
![]() | Family d.15.1.1: Ubiquitin-related [54237] (39 proteins) Pfam PF00240 |
![]() | Protein Nedd8 [54244] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [54245] (10 PDB entries) Uniprot Q15843 |
![]() | Domain d1nddb_: 1ndd B: [37600] complexed with cl, so4 |
PDB Entry: 1ndd (more details), 1.6 Å
SCOPe Domain Sequences for d1nddb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nddb_ d.15.1.1 (B:) Nedd8 {Human (Homo sapiens) [TaxId: 9606]} mlikvktltgkeieidieptdkverikerveekegippqqqrliysgkqmndektaadyk ilggsvlhlvlalrgg
Timeline for d1nddb_: