Lineage for d1ncqc_ (1ncq C:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2086376Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
    sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
    characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies
  4. 2086604Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families) (S)
  5. 2086605Family b.121.4.1: Picornaviridae-like VP (VP1, VP2, VP3 and VP4) [88634] (10 proteins)
    the order of the chains N-VP0-VP3-VP1-C is as in the polyprotein; VP0 is cleaved later upon capsid assembly to VP4 and VP2
    there is a different order in the shuffled genome of insect picorna-like proteins (Cricket paralysis virus)
  6. 2086723Protein Rhinovirus coat proteins [49670] (5 species)
  7. 2086776Species Human rhinovirus B 14 (HRV-14) [TaxId:12131] [49671] (33 PDB entries)
  8. 2086779Domain d1ncqc_: 1ncq C: [91804]
    complexed with w11

Details for d1ncqc_

PDB Entry: 1ncq (more details), 2.5 Å

PDB Description: The structure of HRV14 when complexed with pleconaril, an antiviral compound
PDB Compounds: (C:) coat protein vp3

SCOPe Domain Sequences for d1ncqc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ncqc_ b.121.4.1 (C:) Rhinovirus coat proteins {Human rhinovirus B 14 (HRV-14) [TaxId: 12131]}
glptttlpgsgqflttddrqspsalpnyeptprihipgkvhnlleiiqvdtlipmnntht
kdevnsyliplnanrqneqvfgtnlfigdgvfkttllgeivqyythwsgslrfslmytgp
alssaklilaytppgargpqdrreamlgthvvwdiglqstivmtipwtsgvqfrytdpdt
ytsagflscwyqtslilppettgqvyllsfisacpdfklrlmkdtqtisqtvalte

SCOPe Domain Coordinates for d1ncqc_:

Click to download the PDB-style file with coordinates for d1ncqc_.
(The format of our PDB-style files is described here.)

Timeline for d1ncqc_: