Lineage for d1ncja2 (1ncj A:102-215)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2037192Superfamily b.1.6: Cadherin-like [49313] (3 families) (S)
  5. 2037193Family b.1.6.1: Cadherin [49314] (4 proteins)
  6. 2037271Protein N-cadherin (neural) [49315] (1 species)
  7. 2037272Species Mouse (Mus musculus) [TaxId:10090] [49316] (6 PDB entries)
  8. 2037279Domain d1ncja2: 1ncj A:102-215 [22197]
    two-domain fragment
    complexed with ca, ium

Details for d1ncja2

PDB Entry: 1ncj (more details), 3.4 Å

PDB Description: n-cadherin, two-domain fragment
PDB Compounds: (A:) protein (n-cadherin)

SCOPe Domain Sequences for d1ncja2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ncja2 b.1.6.1 (A:102-215) N-cadherin (neural) {Mouse (Mus musculus) [TaxId: 10090]}
ndnrpeflhqvwngsvpegskpgtyvmtvtaidaddpnalngmlryrivsqapstpspnm
ftinnetgdiitvaagldrekvqqytliiqatdmegnptyglsntatavitvtd

SCOPe Domain Coordinates for d1ncja2:

Click to download the PDB-style file with coordinates for d1ncja2.
(The format of our PDB-style files is described here.)

Timeline for d1ncja2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ncja1