Lineage for d1ncja2 (1ncj A:102-215)
- Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.6: Cadherin-like [49313] (4 families) 
Family b.1.6.1: Cadherin [49314] (4 proteins) 
Protein N-cadherin (neural) [49315] (1 species) Species Mouse (Mus musculus) [TaxId:10090] [49316] (6 PDB entries) 
Domain d1ncja2: 1ncj A:102-215 [22197]
two-domain fragment
complexed with ca, ium
Details for d1ncja2
PDB Entry: 1ncj (more details), 3.4 Å
PDB Description: n-cadherin, two-domain fragment
PDB Compounds: (A:) protein (n-cadherin)SCOPe Domain Sequences for d1ncja2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ncja2 b.1.6.1 (A:102-215) N-cadherin (neural) {Mouse (Mus musculus) [TaxId: 10090]}
ndnrpeflhqvwngsvpegskpgtyvmtvtaidaddpnalngmlryrivsqapstpspnm
ftinnetgdiitvaagldrekvqqytliiqatdmegnptyglsntatavitvtd
SCOPe Domain Coordinates for d1ncja2:
Click to download the PDB-style file with coordinates for d1ncja2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ncja2:
- d1ncja2 first appeared (with stable ids) in SCOP 1.55
- d1ncja2 appears in SCOPe 2.07
View in 3D
