Lineage for d1nc1a_ (1nc1 A:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 996821Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 996837Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families) (S)
    complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8
  5. 996838Family c.56.2.1: Purine and uridine phosphorylases [53168] (7 proteins)
  6. 996896Protein 5'-Methylthioadenosine/S-Adenosylhomocysteine nucleosidase [82448] (3 species)
  7. 996897Species Escherichia coli [TaxId:562] [82449] (8 PDB entries)
  8. 996900Domain d1nc1a_: 1nc1 A: [91779]
    complexed with mth

Details for d1nc1a_

PDB Entry: 1nc1 (more details), 2 Å

PDB Description: Crystal structure of E. coli MTA/AdoHcy nucleosidase complexed with 5'-methylthiotubercidin (MTH)
PDB Compounds: (A:) MTA/SAH nucleosidase

SCOPe Domain Sequences for d1nc1a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nc1a_ c.56.2.1 (A:) 5'-Methylthioadenosine/S-Adenosylhomocysteine nucleosidase {Escherichia coli [TaxId: 562]}
fsmkigiigameeevtllrdkienrqtislggceiytgqlngtevallksgigkvaaalg
atlllehckpdviintgsagglaptlkvgdivvsdearyhdadvtafgyeygqlpgcpag
fkaddkliaaaeaciaelnlnavrglivsgdafingsvglakirhnfpqaiavemeatai
ahvchnfnvpfvvvraisdvadqqshlsfdeflavaakqsslmveslvqklahg

SCOPe Domain Coordinates for d1nc1a_:

Click to download the PDB-style file with coordinates for d1nc1a_.
(The format of our PDB-style files is described here.)

Timeline for d1nc1a_: