Lineage for d1nboa1 (1nbo A:0-148,A:313-334)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 685975Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 685976Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families) (S)
  5. 687227Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (22 proteins)
    family members also share a common alpha+beta fold in C-terminal domain
  6. 687423Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [51801] (18 species)
  7. 687567Species Spinach (Spinacia oleracea) [TaxId:3562] [69409] (8 PDB entries)
  8. 687578Domain d1nboa1: 1nbo A:0-148,A:313-334 [85526]
    Other proteins in same PDB: d1nboa2, d1nbob2, d1nboo2

Details for d1nboa1

PDB Entry: 1nbo (more details), 2.6 Å

PDB Description: The dual coenzyme specificity of photosynthetic glyceraldehyde-3-phosphate dehydrogenase interpreted by the crystal structure of A4 isoform complexed with NAD
PDB Compounds: (A:) glyceraldehyde-3-phosphate dehydrogenase a

SCOP Domain Sequences for d1nboa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nboa1 c.2.1.3 (A:0-148,A:313-334) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Spinach (Spinacia oleracea) [TaxId: 3562]}
klkvaingfgrigrnflrcwhgrkdspldvvvindtggvkqashllkydsilgtfdadvk
tagdsaisvdgkvikvvsdrnpvnlpwgdmgidlviegtgvfvdrdgagkhlqagakkvl
itapgkgdiptyvvgvneegythadtiisnasXnewgysqrvvdladivankwqa

SCOP Domain Coordinates for d1nboa1:

Click to download the PDB-style file with coordinates for d1nboa1.
(The format of our PDB-style files is described here.)

Timeline for d1nboa1:

687578
d1nboa1 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d1nboa2