Lineage for d1nbca_ (1nbc A:)
- Root: SCOPe 2.07
Class b: All beta proteins [48724] (178 folds) 
Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
Superfamily b.2.2: Carbohydrate-binding domain [49384] (4 families) 
Family b.2.2.2: Cellulose-binding domain family III [49390] (9 proteins)
Pfam PF00963
Protein Cellusomal scaffolding protein A, scaffoldin [49391] (3 species) 
Species Clostridium thermocellum [TaxId:1515] [49392] (1 PDB entry) 
Domain d1nbca_: 1nbc A: [22390]
complexed with ca
Details for d1nbca_
PDB Entry: 1nbc (more details), 1.75 Å
PDB Description: bacterial type 3a cellulose-binding domain
PDB Compounds: (A:) cellulosomal scaffolding protein aSCOPe Domain Sequences for d1nbca_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nbca_ b.2.2.2 (A:) Cellusomal scaffolding protein A, scaffoldin {Clostridium thermocellum [TaxId: 1515]}
nlkvefynsnpsdttnsinpqfkvtntgssaidlskltlryyytvdgqkdqtfwcdhaai
igsngsyngitsnvkgtfvkmssstnnadtyleisftggtlepgahvqiqgrfakndwsn
ytqsndysfksasqfvewdqvtaylngvlvwgkep
SCOPe Domain Coordinates for d1nbca_:
Click to download the PDB-style file with coordinates for d1nbca_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1nbca_:
View in 3D
