Lineage for d1nawa_ (1naw A:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.68: IF3-like [55199] (8 superfamilies)
    beta-alpha-beta-alpha-beta(2); 2 layers; mixed sheet 1243, strand 4 is antiparallel to the rest
  4. Superfamily d.68.2: EPT/RTPC-like [55205] (3 families) (S)
  5. Family d.68.2.2: Enolpyruvate transferase, EPT [55209] (3 proteins)
    duplication: 6 repeats of this fold are organized in two RPTC-like domains
    automatically mapped to Pfam PF00275
  6. Protein UDP-N-acetylglucosamine enolpyruvyl transferase (EPT, MurA, MurZ) [55210] (3 species)
  7. Species Enterobacter cloacae [TaxId:550] [55212] (12 PDB entries)
    Uniprot P33038
  8. Domain d1nawa_: 1naw A: [39582]
    complexed with hai

Details for d1nawa_

PDB Entry: 1naw (more details), 2 Å

PDB Description: enolpyruvyl transferase
PDB Compounds: (A:) udp-n-acetylglucosamine 1-carboxyvinyl-transferase

SCOPe Domain Sequences for d1nawa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nawa_ d.68.2.2 (A:) UDP-N-acetylglucosamine enolpyruvyl transferase (EPT, MurA, MurZ) {Enterobacter cloacae [TaxId: 550]}
mdkfrvqgptrlqgevtisgaknaalpilfaallaeepveiqnvpklkdidttmklltql
gtkverngsvwidasnvnnfsapydlvktmrasiwalgplvarfgqgqvslpggcaigar
pvdlhifgleklgaeikleegyvkasvngrlkgahivmdkvsvgatvtimsaatlaegtt
iienaarepeivdtanflvalgakisgqgtdritiegverlgggvyrvlpdrietgtflv
aaaisggkivcrnaqpdtldavlaklreagadietgedwisldmhgkrpkavtvrtaphp
afptdmqaqftllnlvaegtgvitetifenrfmhvpelirmgahaeiesntvichgvekl
sgaqvmatdlrasaslvlagciaegttvvdriyhidrgyeriedklralganiervkge

SCOPe Domain Coordinates for d1nawa_ are not available.

Timeline for d1nawa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1nawb_