| Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
| Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.5: GlnB-like [54913] (6 families) ![]() form timeric structures with the orthogonally packed beta-sheets |
| Family d.58.5.2: Divalent ion tolerance proteins CutA (CutA1) [75434] (4 proteins) |
| Protein Cut A1 [89931] (5 species) |
| Species Escherichia coli [TaxId:562] [102973] (5 PDB entries) |
| Domain d1naqa_: 1naq A: [91761] complexed with hg, mbo |
PDB Entry: 1naq (more details), 1.7 Å
SCOPe Domain Sequences for d1naqa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1naqa_ d.58.5.2 (A:) Cut A1 {Escherichia coli [TaxId: 562]}
sntasvvvlctapdeataqdlaakvlaeklaacatlipgatslyywegkleqeyevqmil
kttvshqqalleclkshhpyqtpellvlpvthgdtdylswlnaslr
Timeline for d1naqa_: