Lineage for d1n9pa_ (1n9p A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2038571Superfamily b.1.18: E set domains [81296] (24 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 2039376Family b.1.18.16: Cytoplasmic domain of inward rectifier potassium channel [81966] (4 proteins)
  6. 2039377Protein G protein-gated inward rectifier Girk1 [81967] (1 species)
    forms tetrameric cytoplasmic pore; contains a C-terminal extension
  7. 2039378Species Mouse (Mus musculus) [TaxId:10090] [81968] (1 PDB entry)
  8. 2039379Domain d1n9pa_: 1n9p A: [80343]

Details for d1n9pa_

PDB Entry: 1n9p (more details), 1.8 Å

PDB Description: crystal structure of the cytoplasmic domain of g-protein activated inward rectifier potassium channel 1
PDB Compounds: (A:) G protein-activated inward rectifier potassium channel 1

SCOPe Domain Sequences for d1n9pa_:

Sequence, based on SEQRES records: (download)

>d1n9pa_ b.1.18.16 (A:) G protein-gated inward rectifier Girk1 {Mouse (Mus musculus) [TaxId: 10090]}
rqrfvdkngrcnvqhgnlgseraetlmfsehavismrdgkltlmfrvgnlrnshmvsaqi
rckllksrqtpegeflpldqleldvgfstgadqlflvspltichvidakspfydlsqrsm
qteqfevvvilegivettgmtcqartsytedevlwghrffpvisleegffkvdysqfhat
fevptppysvkeqeemllmssp

Sequence, based on observed residues (ATOM records): (download)

>d1n9pa_ b.1.18.16 (A:) G protein-gated inward rectifier Girk1 {Mouse (Mus musculus) [TaxId: 10090]}
rqrfvdkngrcnvqheraetlmfsehavismrdgkltlmfrvgnlrnshmvsaqirckll
ksrqtpegeflpldqleldvgfstgadqlflvspltichvidakspfydlsqrsmqteqf
evvvilegivettgmtcqartsytedevlwghrffpvisleegffkvdysqfhatfevpt
ppysvkeqeemllmssp

SCOPe Domain Coordinates for d1n9pa_:

Click to download the PDB-style file with coordinates for d1n9pa_.
(The format of our PDB-style files is described here.)

Timeline for d1n9pa_: