Class g: Small proteins [56992] (91 folds) |
Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies) disulfide-bound fold; contains beta-hairpin with two adjacent disulfides |
Superfamily g.3.9: Growth factor receptor domain [57184] (2 families) |
Family g.3.9.1: Growth factor receptor domain [57185] (9 proteins) |
Protein Protooncoprotein Her2 extracellular domain [82889] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [82890] (2 PDB entries) |
Domain d1n8zc3: 1n8z C:166-322 [80324] Other proteins in same PDB: d1n8za1, d1n8za2, d1n8zb1, d1n8zb2, d1n8zc1, d1n8zc2 complexed with nag, so4 |
PDB Entry: 1n8z (more details), 2.52 Å
SCOPe Domain Sequences for d1n8zc3:
Sequence, based on SEQRES records: (download)
>d1n8zc3 g.3.9.1 (C:166-322) Protooncoprotein Her2 extracellular domain {Human (Homo sapiens) [TaxId: 9606]} rsrachpcspmckgsrcwgessedcqsltrtvcaggcarckgplptdccheqcaagctgp khsdclaclhfnhsgicelhcpalvtyntdtfesmpnpegrytfgascvtacpynylstd vgsctlvcplhnqevtaedgtqrcekcskpcarvcyg
>d1n8zc3 g.3.9.1 (C:166-322) Protooncoprotein Her2 extracellular domain {Human (Homo sapiens) [TaxId: 9606]} rsrachpcspmckgsrcwgessedcqsltrtvcaggcarckgplptdccheqcaagctgp khsdclaclhfnhsgicelhcpalvtyntdtfesmpnpegrytfgascvtacpynylstd vgsctlvcplhnqevtatqrcekcskpcarvcyg
Timeline for d1n8zc3:
View in 3D Domains from other chains: (mouse over for more information) d1n8za1, d1n8za2, d1n8zb1, d1n8zb2 |