Lineage for d1n8la_ (1n8l A:)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 639734Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
    4 helices, bundle; helix 3 is shorter than others; up-and-down
  4. 639735Superfamily a.28.1: ACP-like [47336] (3 families) (S)
  5. 639736Family a.28.1.1: Acyl-carrier protein (ACP) [47337] (5 proteins)
  6. 639769Protein Type I fatty acid synthase ACP domain [89040] (1 species)
  7. 639770Species Rat (Rattus norvegicus) [TaxId:10116] [89041] (2 PDB entries)
  8. 639772Domain d1n8la_: 1n8l A: [85421]

Details for d1n8la_

PDB Entry: 1n8l (more details)

PDB Description: The NMR solution structure of the Type I rat fatty acid synthase ACP domain.
PDB Compounds: (A:) fatty acid synthase

SCOP Domain Sequences for d1n8la_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n8la_ a.28.1.1 (A:) Type I fatty acid synthase ACP domain {Rat (Rattus norvegicus) [TaxId: 10116]}
gdgeaqrdlvkavahilgirdlaginldssladlgldslmgvevrqilerehdlvlpire
vrqltlrklqemsska

SCOP Domain Coordinates for d1n8la_:

Click to download the PDB-style file with coordinates for d1n8la_.
(The format of our PDB-style files is described here.)

Timeline for d1n8la_: