Lineage for d1n82a_ (1n82 A:)
- Root: SCOPe 2.06
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
the first seven superfamilies have similar phosphate-binding sites
Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) 
Family c.1.8.3: beta-glycanases [51487] (27 proteins)
consist of a number of sequence families
Protein Xylanase [51488] (6 species) 
Species Bacillus stearothermophilus, Ixt6 [TaxId:1422] [102063] (7 PDB entries)
intra-cellular xylanase
Domain d1n82a_: 1n82 A: [91703]
complexed with gol, na
Details for d1n82a_
PDB Entry: 1n82 (more details), 1.45 Å
PDB Description: the high-resolution crystal structure of ixt6, a thermophilic, intracellular xylanase from g. stearothermophilus
PDB Compounds: (A:) intra-cellular xylanaseSCOPe Domain Sequences for d1n82a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1n82a_ c.1.8.3 (A:) Xylanase {Bacillus stearothermophilus, Ixt6 [TaxId: 1422]}
nsslpslrdvfandfrigaavnpvtiemqkqllidhvnsitaenhmkfehlqpeegkftf
qeadrivdfacshrmavrghtlvwhnqtpdwvfqdgqghfvsrdvllermkchistvvrr
ykgkiycwdvineavadegdellrpskwrqiigddfmeqaflyayeadpdallfyndyne
cfpekrekifalvkslrdkgipihgigmqahwsltrpsldeiraaieryaslgvvlhite
ldvsmfefhdrrtdlaaptsemierqaerygqifalfkeyrdviqsvtfwgiaddhtwld
nfpvhgrknwpllfdeqhkpkpafwravsv
SCOPe Domain Coordinates for d1n82a_:
Click to download the PDB-style file with coordinates for d1n82a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1n82a_:
- d1n82a_ first appeared in SCOP 1.67
- d1n82a_ appears in SCOPe 2.05
- d1n82a_ appears in SCOPe 2.07
- d1n82a_ appears in the current release, SCOPe 2.08
View in 3D
