Lineage for d1n6ha_ (1n6h A:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1593542Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1593543Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1594390Family c.37.1.8: G proteins [52592] (79 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 1594993Protein Rab5a [82399] (1 species)
  7. 1594994Species Human (Homo sapiens) [TaxId:9606] [82400] (12 PDB entries)
    Uniprot P20339 18-182
  8. 1594996Domain d1n6ha_: 1n6h A: [80197]
    complexed with bme, gnp, mg

Details for d1n6ha_

PDB Entry: 1n6h (more details), 1.51 Å

PDB Description: Crystal Structure of Human Rab5a
PDB Compounds: (A:) Ras-related protein Rab-5A

SCOPe Domain Sequences for d1n6ha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n6ha_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]}
gnkicqfklvllgesavgksslvlrfvkgqfhefqestigaafltqtvclddttvkfeiw
dtagqeryhslapmyyrgaqaaivvyditneesfaraknwvkelqrqaspnivialsgnk
adlankravdfqeaqsyaddnsllfmetsaktsmnvneifmaiakkl

SCOPe Domain Coordinates for d1n6ha_:

Click to download the PDB-style file with coordinates for d1n6ha_.
(The format of our PDB-style files is described here.)

Timeline for d1n6ha_: