Lineage for d1n6aa1 (1n6a A:116-193)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2422468Fold b.76: open-sided beta-meander [51086] (2 superfamilies)
    single sheet formed by beta-hairpin repeats; exposed on both sides in the middle
  4. 2422527Superfamily b.76.2: Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain [82185] (1 family) (S)
    11+ stranded sheet partly folded upon itself at the C-end
  5. 2422528Family b.76.2.1: Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain [82186] (1 protein)
  6. 2422529Protein Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain [82187] (1 species)
  7. 2422530Species Human (Homo sapiens) [TaxId:9606] [82188] (19 PDB entries)
    Uniprot Q8WTS6 52-366
  8. 2422553Domain d1n6aa1: 1n6a A:116-193 [80121]
    Other proteins in same PDB: d1n6aa2
    truncated from N-terminus
    complexed with sam

Details for d1n6aa1

PDB Entry: 1n6a (more details), 1.7 Å

PDB Description: Structure of SET7/9
PDB Compounds: (A:) SET domain-containing protein 7

SCOPe Domain Sequences for d1n6aa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n6aa1 b.76.2.1 (A:116-193) Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
hgvcwiyypdggslvgevnedgemtgekiayvypdertalygkfidgemiegklatlmst
eegrphfelmpgnsvyhf

SCOPe Domain Coordinates for d1n6aa1:

Click to download the PDB-style file with coordinates for d1n6aa1.
(The format of our PDB-style files is described here.)

Timeline for d1n6aa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1n6aa2