Lineage for d1n69a_ (1n69 A:)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 771691Fold a.64: Saposin-like [47861] (2 superfamilies)
    5 helices; folded leaf, closed
  4. 771692Superfamily a.64.1: Saposin [47862] (4 families) (S)
    Lipid-binding can promote conformational changes and oligomerisation in some members
  5. 771715Family a.64.1.3: Saposin B [81806] (1 protein)
    the alternative subunit conformation is an open four-helical bundle; helices 3 and 4 form a contiguous helix
  6. 771716Protein Saposin B [81807] (1 species)
  7. 771717Species Human (Homo sapiens) [TaxId:9606] [81808] (1 PDB entry)
  8. 771718Domain d1n69a_: 1n69 A: [80118]
    the alternative subunit conformation

Details for d1n69a_

PDB Entry: 1n69 (more details), 2.2 Å

PDB Description: crystal structure of human saposin b
PDB Compounds: (A:) saposin b

SCOP Domain Sequences for d1n69a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n69a_ a.64.1.3 (A:) Saposin B {Human (Homo sapiens) [TaxId: 9606]}
gdvcqdciqmvtdiqtavrtnstfvqalvehvkeecdrlgpgmadicknyisqyseiaiq
mmmhmqpkeicalvgfcd

SCOP Domain Coordinates for d1n69a_:

Click to download the PDB-style file with coordinates for d1n69a_.
(The format of our PDB-style files is described here.)

Timeline for d1n69a_: