Lineage for d1n68a2 (1n68 A:171-335)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1774126Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 1774127Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 1774814Family b.6.1.3: Multidomain cupredoxins [49550] (8 proteins)
  6. 1774939Protein multi-copper oxidase CueO [69194] (1 species)
  7. 1774940Species Escherichia coli [TaxId:562] [69195] (29 PDB entries)
  8. 1774993Domain d1n68a2: 1n68 A:171-335 [85357]
    complexed with c2c, cu

Details for d1n68a2

PDB Entry: 1n68 (more details), 1.7 Å

PDB Description: Copper bound to the Multicopper Oxidase CueO
PDB Compounds: (A:) Blue copper oxidase cueO

SCOPe Domain Sequences for d1n68a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n68a2 b.6.1.3 (A:171-335) multi-copper oxidase CueO {Escherichia coli [TaxId: 562]}
mlpkqwgiddvpvivqdkkfsadgqidyqldvmtaavgwfgdtlltngaiypqhaaprgw
lrlrllngcnarslnfatsdnrplyviasdggllpepvkvselpvlmgerfevlvevndn
kpfdlvtlpvsqmgmaiapfdkphpvmriqpiaisasgalpdtls

SCOPe Domain Coordinates for d1n68a2:

Click to download the PDB-style file with coordinates for d1n68a2.
(The format of our PDB-style files is described here.)

Timeline for d1n68a2: