| Class a: All alpha proteins [46456] (286 folds) |
| Fold a.126: Serum albumin-like [48551] (1 superfamily) multihelical; one domain consists of two similar disulfide-linked subdomains |
Superfamily a.126.1: Serum albumin-like [48552] (2 families) ![]() |
| Family a.126.1.1: Serum albumin-like [48553] (2 proteins) |
| Protein Serum albumin [48554] (1 species) duplication: consists of three domains of this fold |
| Species Human (Homo sapiens) [TaxId:9606] [48555] (70 PDB entries) Uniprot P02768 29-596 |
| Domain d1n5ua3: 1n5u A:389-584 [85341] complexed with hem, myr |
PDB Entry: 1n5u (more details), 1.9 Å
SCOPe Domain Sequences for d1n5ua3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1n5ua3 a.126.1.1 (A:389-584) Serum albumin {Human (Homo sapiens) [TaxId: 9606]}
kqncelfeqlgeykfqnallvrytkkvpqvstptlvevsrnlgkvgskcckhpeakrmpc
aedylsvvlnqlcvlhektpvsdrvtkccteslvnrrpcfsalevdetyvpkefnaetft
fhadictlsekerqikkqtalvelvkhkpkatkeqlkavmddfaafvekcckaddketcf
aeegkklvaasqaalg
Timeline for d1n5ua3: