Lineage for d1n5na_ (1n5n A:)
- Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds) 
Fold d.167: Peptide deformylase [56419] (1 superfamily)
alpha-beta(5)-alpha; 3 layers: a/b/a; meander beta-sheet wraps around the C-terminal alpha-helixSuperfamily d.167.1: Peptide deformylase [56420] (2 families) 
nickel-dependent enzymeFamily d.167.1.1: Peptide deformylase [56421] (2 proteins)
automatically mapped to Pfam PF01327Protein Peptide deformylase [56422] (11 species) 
Species Pseudomonas aeruginosa [TaxId:287] [75578] (4 PDB entries) 
Domain d1n5na_: 1n5n A: [85336]
complexed with gol, zn
Details for d1n5na_
PDB Entry: 1n5n (more details), 1.8 Å
PDB Description: crystal structure of peptide deformylase from pseudomonas aeruginosa
PDB Compounds: (A:) Peptide deformylaseSCOPe Domain Sequences for d1n5na_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1n5na_ d.167.1.1 (A:) Peptide deformylase {Pseudomonas aeruginosa [TaxId: 287]}
mailnilefpdprlrtiakpvevvddavrqliddmfetmyeapgiglaatqvnvhkrivv
mdlsedkseprvfinpefeplteemdqyqegclsvpgfyenvdrpqkvrikaldrdgnpf
eevaegllavciqhecdhlngklfvdylstlkrdrirkklekqhrqq
SCOPe Domain Coordinates for d1n5na_:
Click to download the PDB-style file with coordinates for d1n5na_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1n5na_:
- d1n5na_ first appeared in SCOP 1.65
- d1n5na_ appears in SCOPe 2.07
View in 3D
