Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.127: Creatinase/aminopeptidase [55919] (1 superfamily) duplication: composed of two very similar alpha+beta folds |
Superfamily d.127.1: Creatinase/aminopeptidase [55920] (2 families) |
Family d.127.1.1: Creatinase/aminopeptidase [55921] (4 proteins) |
Protein Aminopeptidase P, C-terminal domain [55928] (2 species) |
Species Escherichia coli [TaxId:562] [55929] (20 PDB entries) |
Domain d1n51a2: 1n51 A:177-440 [91679] Other proteins in same PDB: d1n51a1 complexed with mn |
PDB Entry: 1n51 (more details), 2.3 Å
SCOPe Domain Sequences for d1n51a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1n51a2 d.127.1.1 (A:177-440) Aminopeptidase P, C-terminal domain {Escherichia coli [TaxId: 562]} speeiavlrrageitamahtramekcrpgmfeyhlegeihhefnrhgarypsyntivgsg engcilhytenecemrdgdlvlidagceykgyagditrtfpvngkftqaqreiydivles letslrlyrpgtsilevtgevvrimvsglvklgilkgdvdeliaqnahrpffmhglshwl gldvhdvgvygqdrsrilepgmvltvepglyiapdaevpeqyrgigirieddivitetgn enltasvvkkpeeiealmvaarkq
Timeline for d1n51a2: