Lineage for d1n4wa1 (1n4w A:9-318,A:451-507)
- Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meanderSuperfamily c.3.1: FAD/NAD(P)-binding domain [51905] (9 families) 
Family c.3.1.2: FAD-linked reductases, N-terminal domain [51913] (18 proteins)
C-terminal domain is alpha+beta is common for the familyProtein Cholesterol oxidase of GMC family [51914] (3 species) Species Streptomyces sp. [TaxId:1931] [51916] (14 PDB entries) 
Domain d1n4wa1: 1n4w A:9-318,A:451-507 [91676]
Other proteins in same PDB: d1n4wa2
complexed with fad, gol, mn
Details for d1n4wa1
PDB Entry: 1n4w (more details), 0.92 Å
PDB Description: atomic resolution structure of cholesterol oxidase @ ph 7.3 (streptomyces sp. sa-coo)
PDB Compounds: (A:) cholesterol oxidaseSCOPe Domain Sequences for d1n4wa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1n4wa1 c.3.1.2 (A:9-318,A:451-507) Cholesterol oxidase of GMC family {Streptomyces sp. [TaxId: 1931]}
gyvpavvigtgygaavsalrlgeagvqtlmlemgqlwnqpgpdgnifcgmlnpdkrsswf
knrteaplgsflwldvvnrnidpyagvldrvnydqmsvyvgrgvgggslvnggmavepkr
syfeeilprvdssemydryfpransmlrvnhidtkwfedtewykfarvsreqagkaglgt
vfvpnvydfgymqreaagevpksalateviygnnhgkqsldktylaaalgtgkvtiqtlh
qvktirqtkdggyaltveqkdtdgkllatkeiscrylflgagslgstellvrardtgtlp
nlnsevgagwXgcvlgkatddygrvagyknlyvtdgslipgsvgvnpfvtitalaernve
riikqdvt
SCOPe Domain Coordinates for d1n4wa1:
Click to download the PDB-style file with coordinates for d1n4wa1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1n4wa1:
- d1n4wa1 first appeared in SCOP 1.67
- d1n4wa1 appears in SCOPe 2.07
View in 3D
