Lineage for d1n48a1 (1n48 A:241-342)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 881225Fold d.240: Lesion bypass DNA polymerase (Y-family), little finger domain [100878] (1 superfamily)
    beta-alpha-beta(2)-alpha-beta; antiparallel beta-sheet: order 1423; "reversed" ferredoxin-like topology
  4. 881226Superfamily d.240.1: Lesion bypass DNA polymerase (Y-family), little finger domain [100879] (1 family) (S)
  5. 881227Family d.240.1.1: Lesion bypass DNA polymerase (Y-family), little finger domain [100880] (5 proteins)
  6. 881228Protein DinB homolog (DBH) [100881] (3 species)
  7. 881233Species Archaeon Sulfolobus solfataricus, DNA polymerase IV [TaxId:2287] [100882] (50 PDB entries)
  8. 881254Domain d1n48a1: 1n48 A:241-342 [91615]
    Other proteins in same PDB: d1n48a2
    complexed with 3dr, atp, ca

Details for d1n48a1

PDB Entry: 1n48 (more details), 2.2 Å

PDB Description: Y-family DNA polymerase Dpo4 in complex with DNA containing abasic lesion
PDB Compounds: (A:) DNA polymerase IV

SCOP Domain Sequences for d1n48a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n48a1 d.240.1.1 (A:241-342) DinB homolog (DBH) {Archaeon Sulfolobus solfataricus, DNA polymerase IV [TaxId: 2287]}
vrksigrivtmkrnsrnleeikpylfraieesyykldkripkaihvvavtedldivsrgr
tfphgisketaysesvkllqkileederkirrigvrfskfie

SCOP Domain Coordinates for d1n48a1:

Click to download the PDB-style file with coordinates for d1n48a1.
(The format of our PDB-style files is described here.)

Timeline for d1n48a1:

881254
d1n48a1 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d1n48a2