Lineage for d1n3oa_ (1n3o A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2387948Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2387949Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2387950Family b.29.1.1: Legume lectins [49900] (5 proteins)
  6. 2388157Protein Legume lectin [49904] (23 species)
  7. 2388161Species Bloodwood tree (Pterocarpus angolensis) [TaxId:182271] [82032] (9 PDB entries)
  8. 2388168Domain d1n3oa_: 1n3o A: [79967]
    complexed with ca, gyp, mn

Details for d1n3oa_

PDB Entry: 1n3o (more details), 2 Å

PDB Description: pterocarcpus angolensis lectin in complex with alpha-methyl glucose
PDB Compounds: (A:) lectin PAL

SCOPe Domain Sequences for d1n3oa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n3oa_ b.29.1.1 (A:) Legume lectin {Bloodwood tree (Pterocarpus angolensis) [TaxId: 182271]}
qdslsfgfptfpsdqknlifqgdaqiknnavqltktdsngnpvastvgrilfsaqvhlwe
ksssrvanfqsqfsfslksplsngadgiaffiappdttipsgsgggllglfapgtaqnts
anqviavefdtfyaqdsntwdpnyphigidvnsirsvktvkwdrrdgqslnvlvtfnpst
rnldvvatysdgtryevsyevdvrsvlpewvrvgfsaasgeqyqthtleswsftstllyt
a

SCOPe Domain Coordinates for d1n3oa_:

Click to download the PDB-style file with coordinates for d1n3oa_.
(The format of our PDB-style files is described here.)

Timeline for d1n3oa_: