Lineage for d1n2za_ (1n2z A:)
- Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.92: Chelatase-like [53799] (3 superfamilies)
duplication: tandem repeat of two domains; 3 layers (a/b/a); parallel beta-sheet of 4 strands, order 2134Superfamily c.92.2: 'Helical backbone' metal receptor [53807] (5 families) 
contains a long alpha helical insertion in the interdomain linker
Family c.92.2.2: TroA-like [53811] (6 proteins) 
Protein Vitamin B12 binding protein BtuF [82557] (2 species) Species Escherichia coli [TaxId:562] [82558] (4 PDB entries) 
Domain d1n2za_: 1n2z A: [79865]
complexed with cd, cl, cnc, pg4
Details for d1n2za_
PDB Entry: 1n2z (more details), 2 Å
PDB Description: 2.0 angstrom structure of btuf, the vitamin b12 binding protein of e. coli
PDB Compounds: (A:) Vitamin B12 transport protein btuFSCOPe Domain Sequences for d1n2za_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1n2za_ c.92.2.2 (A:) Vitamin B12 binding protein BtuF {Escherichia coli [TaxId: 562]}
aaprvitlspantelafaagitpvgvssysdyppqaqkieqvstwqgmnlerivalkpdl
viawrggnaerqvdqlaslgikvmwvdatsieqianalrqlapwspqpdkaeqaaqslld
qyaqlkaqyadkpkkrvflqfginppftsgkesiqnqvlevcggenifkdsrvpwpqvsr
eqvlarspqaivitggpdqipkikqywgeqlkipvipltsdwferaspriilaaqqlcna
lsqvd
SCOPe Domain Coordinates for d1n2za_:
Click to download the PDB-style file with coordinates for d1n2za_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1n2za_:
- d1n2za_ first appeared in SCOP 1.63
- d1n2za_ appears in SCOPe 2.07
View in 3D
