Lineage for d1n2ga_ (1n2g A:)
- Root: SCOPe 2.07
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) 
Family c.26.1.4: Pantothenate synthetase (Pantoate-beta-alanine ligase, PanC) [63976] (2 proteins)
contains C-terminal subdomain similar to one structural repeat of the Creatinase/aminopeptidase family
automatically mapped to Pfam PF02569Protein Pantothenate synthetase (Pantoate-beta-alanine ligase, PanC) [63977] (5 species) Species Mycobacterium tuberculosis [TaxId:1773] [89615] (48 PDB entries) 
Domain d1n2ga_: 1n2g A: [85270]
structural genomics
complexed with apc, eoh, gol, mg, so4
Details for d1n2ga_
PDB Entry: 1n2g (more details), 1.8 Å
PDB Description: crystal structure of a pantothenate synthetase from m. tuberculosis in complex with ampcpp
PDB Compounds: (A:) Pantothenate synthetaseSCOPe Domain Sequences for d1n2ga_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1n2ga_ c.26.1.4 (A:) Pantothenate synthetase (Pantoate-beta-alanine ligase, PanC) {Mycobacterium tuberculosis [TaxId: 1773]}
ipafhpgelnvysapgdvadvsralrltgrrvmlvptmgalheghlalvraakrvpgsvv
vvsifvnpmqfgaggdldayprtpdddlaqlraegveiaftpttaamypdglrttvqpgp
laaeleggprpthfagvltvvlkllqivrpdrvffgekdyqqlvlirqlvadfnldvavv
gvptvreadglamssrnryldpaqraaavalsaaltaaahaatagaqaaldaaravldaa
pgvavdylelrdiglgpmplngsgrllvaarlgttrlldniaieigtfa
SCOPe Domain Coordinates for d1n2ga_:
Click to download the PDB-style file with coordinates for d1n2ga_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1n2ga_:
- d1n2ga_ first appeared in SCOP 1.65
- d1n2ga_ appears in SCOPe 2.06
- d1n2ga_ appears in the current release, SCOPe 2.08
View in 3D
