Lineage for d1n10a2 (1n10 A:1003-1145)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2802576Fold b.52: Double psi beta-barrel [50684] (2 superfamilies)
    barrel, closed; n=6, S=10; complex topology with crossover (psi) loops
  4. 2802577Superfamily b.52.1: Barwin-like endoglucanases [50685] (5 families) (S)
  5. 2802610Family b.52.1.3: Pollen allergen PHL P 1 N-terminal domain [82135] (1 protein)
    conserved Eng V active site residues and disulfides; better structural similarity to the ADC-like superfamily
  6. 2802611Protein Pollen allergen PHL P 1 N-terminal domain [82136] (1 species)
  7. 2802612Species Timothy grass (Phleum pratense) [TaxId:15957] [82137] (1 PDB entry)
  8. 2802613Domain d1n10a2: 1n10 A:1003-1145 [79775]
    Other proteins in same PDB: d1n10a1, d1n10b1
    complexed with nag

Details for d1n10a2

PDB Entry: 1n10 (more details), 2.9 Å

PDB Description: crystal structure of phl p 1, a major timothy grass pollen allergen
PDB Compounds: (A:) Pollen allergen Phl p 1

SCOPe Domain Sequences for d1n10a2:

Sequence, based on SEQRES records: (download)

>d1n10a2 b.52.1.3 (A:1003-1145) Pollen allergen PHL P 1 N-terminal domain {Timothy grass (Phleum pratense) [TaxId: 15957]}
pkvppgpnitatygdkwldakstwygkptgagpkdnggacgykdvdkppfsgmtgcgntp
ifksgrgcgscfeikctkpeacsgepvvvhitddneepiapyhfdlsghafgamakkgde
qklrsagelelqfrrvkckypeg

Sequence, based on observed residues (ATOM records): (download)

>d1n10a2 b.52.1.3 (A:1003-1145) Pollen allergen PHL P 1 N-terminal domain {Timothy grass (Phleum pratense) [TaxId: 15957]}
pkvppgpnitatygdkwldakstwygggacgykdvdkppfsgmtgcgntpifksgrgcgs
cfeikctkpeacsgepvvvhitddneepiapyhfdlsghafgamakkgdeqklrsagele
lqfrrvkckypeg

SCOPe Domain Coordinates for d1n10a2:

Click to download the PDB-style file with coordinates for d1n10a2.
(The format of our PDB-style files is described here.)

Timeline for d1n10a2:

2802613
d1n10a2 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d1n10a1