Lineage for d1n10a1 (1n10 A:1146-1240)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1304037Fold b.7: C2 domain-like [49561] (5 superfamilies)
    sandwich; 8 strands in 2 sheets; greek-key
  4. 1304324Superfamily b.7.3: PHL pollen allergen [49590] (2 families) (S)
  5. 1304325Family b.7.3.1: PHL pollen allergen [49591] (3 proteins)
    automatically mapped to Pfam PF01357
  6. 1304326Protein PHL P 1 C-terminal domain [82001] (1 species)
  7. 1304327Species Timothy grass (Phleum pratense) [TaxId:15957] [82002] (1 PDB entry)
  8. 1304328Domain d1n10a1: 1n10 A:1146-1240 [79774]
    Other proteins in same PDB: d1n10a2, d1n10b2
    complexed with nag

Details for d1n10a1

PDB Entry: 1n10 (more details), 2.9 Å

PDB Description: crystal structure of phl p 1, a major timothy grass pollen allergen
PDB Compounds: (A:) Pollen allergen Phl p 1

SCOPe Domain Sequences for d1n10a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n10a1 b.7.3.1 (A:1146-1240) PHL P 1 C-terminal domain {Timothy grass (Phleum pratense) [TaxId: 15957]}
tkvtfhvekgsnpnylallvkyvngdgdvvavdikekgkdkwielkeswgaiwridtpdk
ltgpftvrytteggtkteaedvipegwkadtsyes

SCOPe Domain Coordinates for d1n10a1:

Click to download the PDB-style file with coordinates for d1n10a1.
(The format of our PDB-style files is described here.)

Timeline for d1n10a1:

1304328
d1n10a1 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d1n10a2