![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.11: EF-G C-terminal domain-like [54980] (4 families) ![]() |
![]() | Family d.58.11.1: EF-G/eEF-2 domains III and V [54981] (5 proteins) domain III structure is lacking some of the superfamily characters and is often disordered in crystals |
![]() | Protein Elongation factor 2 (eEF-2), N-terminal domain [419042] (2 species) |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [419527] (13 PDB entries) Uniprot P32324 |
![]() | Domain d1n0vc4: 1n0v C:482-560 [79765] Other proteins in same PDB: d1n0vc1, d1n0vc2, d1n0vc3, d1n0vc5, d1n0vd1, d1n0vd2, d1n0vd3, d1n0vd5 |
PDB Entry: 1n0v (more details), 2.85 Å
SCOPe Domain Sequences for d1n0vc4:
Sequence; same for both SEQRES and ATOM records: (download)
>d1n0vc4 d.58.11.1 (C:482-560) Elongation factor 2 (eEF-2), N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} kfsvspvvqvavevknandlpklveglkrlsksdpcvltymsesgehivagtgelhleic lqdlehdhagvplkisppv
Timeline for d1n0vc4: