Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.11: PapD-like [49354] (3 families) contains PP switch between strands D and C' |
Family b.1.11.1: Pilus chaperone [49355] (6 proteins) automatically mapped to Pfam PF00345 |
Protein Pilus chaperone PapD, N-domain [49356] (1 species) consists of two domains of this fold; domain 2 has an additional strand at the C-terminus |
Species Escherichia coli [TaxId:562] [49357] (15 PDB entries) |
Domain d1n0la1: 1n0l A:1-124 [79744] Other proteins in same PDB: d1n0la2, d1n0lb_, d1n0lc2, d1n0ld_ |
PDB Entry: 1n0l (more details), 2.3 Å
SCOPe Domain Sequences for d1n0la1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1n0la1 b.1.11.1 (A:1-124) Pilus chaperone PapD, N-domain {Escherichia coli [TaxId: 562]} avsldrtravfdgseksmtldisndnkqlpylaqawienenqekiitgpviatppvqrle pgaksmvrlsttpdisklpqdreslfyfnlreipprsekanvlqialqtkiklfyrpaai ktrp
Timeline for d1n0la1:
View in 3D Domains from other chains: (mouse over for more information) d1n0lb_, d1n0lc1, d1n0lc2, d1n0ld_ |