| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.2: Long alpha-hairpin [46556] (20 superfamilies) 2 helices; antiparallel hairpin, left-handed twist |
Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (2 families) ![]() automatically mapped to Pfam PF00081 |
| Family a.2.11.1: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46610] (4 proteins) |
| Protein Mn superoxide dismutase (MnSOD) [46618] (9 species) |
| Species Human (Homo sapiens) [TaxId:9606] [46619] (35 PDB entries) |
| Domain d1n0ja1: 1n0j A:1-83 [79740] Other proteins in same PDB: d1n0ja2, d1n0jb2 complexed with mn |
PDB Entry: 1n0j (more details), 2.2 Å
SCOPe Domain Sequences for d1n0ja1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1n0ja1 a.2.11.1 (A:1-83) Mn superoxide dismutase (MnSOD) {Human (Homo sapiens) [TaxId: 9606]}
khslpdlpydygalephinaqimqlhhskhhaayvnnlnvteekyqealakgdvtaqial
qpalkfnggghinhsifwtnlsp
Timeline for d1n0ja1: