Lineage for d1mzgb_ (1mzg B:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1945491Fold d.224: SufE/NifU [82648] (1 superfamily)
    alpha(2)-beta(3)-alpha(3); 2 layers alpha/beta, 3-stranded antiparallel beta-sheet; order 123
  4. 1945492Superfamily d.224.1: SufE/NifU [82649] (4 families) (S)
    iron-sulfur cluster assembly proteins
  5. 1945493Family d.224.1.1: SufE-like [82650] (3 proteins)
    Fe-S metabolism associated domain
    automatically mapped to Pfam PF02657
  6. 1945497Protein SufE (YhnA) [82651] (1 species)
    unknown function; probably involved in Fe-S center assembly
  7. 1945498Species Escherichia coli [TaxId:562] [82652] (1 PDB entry)
  8. 1945500Domain d1mzgb_: 1mzg B: [79697]
    structural genomics

Details for d1mzgb_

PDB Entry: 1mzg (more details), 2 Å

PDB Description: X-Ray Structure of SufE from E.coli Northeast Structural Genomics (NESG) Consortium Target ER30
PDB Compounds: (B:) SufE Protein

SCOPe Domain Sequences for d1mzgb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mzgb_ d.224.1.1 (B:) SufE (YhnA) {Escherichia coli [TaxId: 562]}
allpdkekllrnflrcanweekylyiielgqrlpelrdedrspqnsiqgcqsqvwivmrq
naqgiielqgdsdaaivkgliavvfilydqmtpqdivnfdvrpwfekmaltqhltpsrsq
gleamirairakaaalslehhhh

SCOPe Domain Coordinates for d1mzgb_:

Click to download the PDB-style file with coordinates for d1mzgb_.
(The format of our PDB-style files is described here.)

Timeline for d1mzgb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1mzga_