Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.4: His-Me finger endonucleases [54059] (1 superfamily) core: (alpha)-beta-omega_loop-beta-alpha; embeded in larger different structures |
Superfamily d.4.1: His-Me finger endonucleases [54060] (8 families) common motif contains conserved histidine residue and metal-binding site |
Family d.4.1.1: HNH-motif [54061] (3 proteins) |
Protein DNase domain of colicin E7 [54062] (1 species) |
Species Escherichia coli [TaxId:562] [54063] (10 PDB entries) |
Domain d1mz8b_: 1mz8 B: [79684] Other proteins in same PDB: d1mz8a_, d1mz8c_ complexed with po4, zn |
PDB Entry: 1mz8 (more details), 2 Å
SCOPe Domain Sequences for d1mz8b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mz8b_ d.4.1.1 (B:) DNase domain of colicin E7 {Escherichia coli [TaxId: 562]} krnkpgkatgkgkpvnnkwlnnagkdlgspvpdrianklrdkefksfddfrkkfweevsk dpelskqfsrnnndrmkvgkapktrtqdvsgkrtsfelhhekpisqnggvydmdnisvvt pkrhidihrgk
Timeline for d1mz8b_: