Lineage for d1mz8b_ (1mz8 B:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2535017Fold d.4: His-Me finger endonucleases [54059] (1 superfamily)
    core: (alpha)-beta-omega_loop-beta-alpha; embeded in larger different structures
  4. 2535018Superfamily d.4.1: His-Me finger endonucleases [54060] (8 families) (S)
    common motif contains conserved histidine residue and metal-binding site
  5. 2535019Family d.4.1.1: HNH-motif [54061] (3 proteins)
  6. 2535020Protein DNase domain of colicin E7 [54062] (1 species)
  7. 2535021Species Escherichia coli [TaxId:562] [54063] (10 PDB entries)
  8. 2535031Domain d1mz8b_: 1mz8 B: [79684]
    Other proteins in same PDB: d1mz8a_, d1mz8c_
    complexed with po4, zn

Details for d1mz8b_

PDB Entry: 1mz8 (more details), 2 Å

PDB Description: crystal structures of the nuclease domain of cole7/im7 in complex with a phosphate ion and a zinc ion
PDB Compounds: (B:) colicin e7

SCOPe Domain Sequences for d1mz8b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mz8b_ d.4.1.1 (B:) DNase domain of colicin E7 {Escherichia coli [TaxId: 562]}
krnkpgkatgkgkpvnnkwlnnagkdlgspvpdrianklrdkefksfddfrkkfweevsk
dpelskqfsrnnndrmkvgkapktrtqdvsgkrtsfelhhekpisqnggvydmdnisvvt
pkrhidihrgk

SCOPe Domain Coordinates for d1mz8b_:

Click to download the PDB-style file with coordinates for d1mz8b_.
(The format of our PDB-style files is described here.)

Timeline for d1mz8b_: