![]() | Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
![]() | Fold d.211: beta-hairpin-alpha-hairpin repeat [74651] (2 superfamilies) multiple repeats of beta(2)-alpha(2) motif |
![]() | Superfamily d.211.1: Ankyrin repeat [48403] (2 families) ![]() repeats organized in elongated structures |
![]() | Family d.211.1.1: Ankyrin repeat [48404] (19 proteins) this is a repeat family; one repeat unit is 1ixv A:101-134 found in domain |
![]() | Protein Myotrophin [48419] (2 species) |
![]() | Species Norway rat (Rattus norvegicus) [TaxId:10116] [48420] (2 PDB entries) |
![]() | Domain d1myoa_: 1myo A: [19174] |
PDB Entry: 1myo (more details)
SCOPe Domain Sequences for d1myoa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1myoa_ d.211.1.1 (A:) Myotrophin {Norway rat (Rattus norvegicus) [TaxId: 10116]} mcdkefmwalkngdldevkdyvakgedvnrtleggrkplhyaadcgqleileflllkgad inapdkhhitpllsavyeghvscvklllskgadktvkgpdgltaleatdnqaikallq
Timeline for d1myoa_: