| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.18: E set domains [81296] (27 families) ![]() "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
| Family b.1.18.1: NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain [81279] (8 proteins) subgroup of the larger IPT/TIG domain family |
| Protein p65 subunit of NF-kappa B (NFKB), dimerization domain [49253] (3 species) |
| Species Mouse (Mus musculus) [TaxId:10090] [49254] (13 PDB entries) |
| Domain d1my7a_: 1my7 A: [79675] mutant |
PDB Entry: 1my7 (more details), 1.49 Å
SCOPe Domain Sequences for d1my7a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1my7a_ b.1.18.1 (A:) p65 subunit of NF-kappa B (NFKB), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]}
taelkicrvnrrsgsclggdeifllcdkvqkedievyftgpgweargsfsqadvhrqvai
vfrtppyadpslqapvrvsmqlrrpsdrelsepmefqylpdtddrhr
Timeline for d1my7a_: