Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.10: Aldolase [51569] (9 families) Common fold covers whole protein structure |
Family c.1.10.1: Class I aldolase [51570] (13 proteins) the catalytic lysine forms schiff-base intermediate with substrate possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels |
Protein KDPG aldolase [51584] (3 species) |
Species Pseudomonas putida [TaxId:303] [102091] (1 PDB entry) |
Domain d1mxsa_: 1mxs A: [91494] complexed with so4 |
PDB Entry: 1mxs (more details), 2.2 Å
SCOPe Domain Sequences for d1mxsa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mxsa_ c.1.10.1 (A:) KDPG aldolase {Pseudomonas putida [TaxId: 303]} lsmadkaaridaicekarilpvitiareedilpladalaaggirtlevtlrsqhglkaiq vlreqrpelcvgagtvldrsmfaaveaagaqfvvtpgitedileagvdseipllpgistp seimmgyalgyrrfklfpaeisggvaaikafggpfgdirfcptggvnpanvrnymalpnv mcvgttwmldsswikngdwarieacsaeaialldan
Timeline for d1mxsa_: