| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.211: beta-hairpin-alpha-hairpin repeat [74651] (2 superfamilies) multiple repeats of beta(2)-alpha(2) motif |
Superfamily d.211.1: Ankyrin repeat [48403] (2 families) ![]() repeats organized in elongated structures |
| Family d.211.1.1: Ankyrin repeat [48404] (21 proteins) this is a repeat family; one repeat unit is 1ixv A:101-134 found in domain |
| Protein p18ink4C(ink6) [48412] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [48413] (6 PDB entries) |
| Domain d1mx4b_: 1mx4 B: [79641] |
PDB Entry: 1mx4 (more details), 2 Å
SCOPe Domain Sequences for d1mx4b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mx4b_ d.211.1.1 (B:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]}
pwgnelasaaargdleqltsllqnnvnvnaqngfgrtalqvmklgnpeiarrlllrganp
dlkdrtgfavihdaaragqldtlqtllefqadvniednegnlplhlaakeghlrvveflv
khtasnvghrnhkgdtacdlarlygrnevvslmqangag
Timeline for d1mx4b_: