Details for d1mx0a3

PDB Entry: 1mx0 (more details), 2.3 Å

PDB Compounds: (A:) Type II DNA topoisomerase VI subunit B

SCOP Domain Sequences for d1mx0a3:

Sequence, based on SEQRES records: (download)

>d1mx0a3 d.122.1.2 (A:4-228) Topoisomerase VI-B subunit {Archaeon Sulfolobus shibatae [TaxId: 2286]}
kekftslspaeffkrnpelagfpnparalyqtvreliensldatdvhgilpnikitidli
ddarqiykvnvvdngigippqevpnafgrvlysskyvnrqtrgmyglgvkaavlysqmhq
dkpieietspvnskriytfklkidinknepiivergsventrgfhgtsvaisipgdwpka
ksriyeyikrtyiitpyaefifkdpegnvtyyprltnkipkppqe

Sequence, based on observed residues (ATOM records): (download)

>d1mx0a3 d.122.1.2 (A:4-228) Topoisomerase VI-B subunit {Archaeon Sulfolobus shibatae [TaxId: 2286]}
kekftslspaeffkrnpelagfpnparalyqtvreliensldatdvhgilpnikitidli
ddarqiykvnvvdngigippqevpnafgrvlysskyvnrqtrgmyglgvkaavlysqmhq
dkpieietspvnskriytfklkidinknepiivergsvenfhgtsvaisipgdwpkaksr
iyeyikrtyiitpyaefifkdpegnvtyyprltnkipkppqe

SCOP Domain Coordinates for d1mx0a3:

Timeline for d1mx0a3:

• d1mx0a3 first appeared in SCOP 1.63
  
• d1mx0a3 appears in SCOP 1.71
  
• d1mx0a3 appears in SCOP 1.75
  
• d1mx0a3 appears in the current release, SCOPe 2.08
  

Thumbnails for d1mx0a3:

d1mx0a3 (click for larger image) View in 3D

d1mx0a3 in context of chain d1mx0a1 in context of chain d1mx0a2 in context of chain View in 3D Domains from same chain: (mouse over for more information) d1mx0a1, d1mx0a2

d1mx0a3 in context of PDB d1mx0b1 in context of PDB d1mx0b2 in context of PDB d1mx0b3 in context of PDB d1mx0c1 in context of PDB d1mx0c2 in context of PDB d1mx0c3 in context of PDB d1mx0d1 in context of PDB d1mx0d2 in context of PDB d1mx0d3 in context of PDB d1mx0e1 in context of PDB d1mx0e2 in context of PDB d1mx0e3 in context of PDB d1mx0f1 in context of PDB d1mx0f2 in context of PDB d1mx0f3 in context of PDB View in 3D Domains from other chains: (mouse over for more information) d1mx0b1, d1mx0b2, d1mx0b3, d1mx0c1, d1mx0c2, d1mx0c3, d1mx0d1, d1mx0d2, d1mx0d3, d1mx0e1, d1mx0e2, d1mx0e3, d1mx0f1, d1mx0f2, d1mx0f3