| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) ![]() division into families based on beta-sheet topologies |
| Family c.37.1.12: ABC transporter ATPase domain-like [52686] (25 proteins) there are two additional subdomains inserted into the central core that has a RecA-like topology |
| Protein Multidrug resistance ABC transporter LmrA, C-terminal domain [102381] (1 species) |
| Species Lactococcus lactis [TaxId:1358] [102382] (1 PDB entry) |
| Domain d1mv5a_: 1mv5 A: [91469] complexed with adp, atp, mg |
PDB Entry: 1mv5 (more details), 3.1 Å
SCOPe Domain Sequences for d1mv5a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]}
mlsarhvdfayddseqilrdisfeaqpnsiiafagpsgggkstifsllerfyqptageit
idgqpidnislenwrsqigfvsqdsaimagtirenltyglegdytdedlwqvldlafars
fvenmpdqlntevgergvkisggqrqrlaiaraflrnpkilmldeatasldsesesmvqk
aldslmkgrttlviahrlstivdadkiyfiekgqitgsgkhnelvathplyakyvseqlt
vg
Timeline for d1mv5a_: