Lineage for d1mv0b_ (1mv0 B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2782725Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2782861Superfamily b.34.2: SH3-domain [50044] (2 families) (S)
  5. 2782862Family b.34.2.1: SH3-domain [50045] (40 proteins)
  6. 2782926Protein Amphiphysin 2 [50080] (1 species)
    synonyms: Myc box dependent interacting protein 1, bin1
  7. 2782927Species Norway rat (Rattus norvegicus) [TaxId:10116] [50081] (4 PDB entries)
  8. 2782929Domain d1mv0b_: 1mv0 B: [91467]
    complexed with c-Myc peptide, chain A

Details for d1mv0b_

PDB Entry: 1mv0 (more details)

PDB Description: nmr structure of the tumor suppressor bin1: alternative splicing in melanoma and interaction with c-myc
PDB Compounds: (B:) Myc box-dependent-interacting protein 1

SCOPe Domain Sequences for d1mv0b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mv0b_ b.34.2.1 (B:) Amphiphysin 2 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
grldlppgfmfkvqaqhdytatdtdelqlkagdvvlvipfqnpeeqdegwlmgvkesdwn
qhkklekcrgvfpenftervp

SCOPe Domain Coordinates for d1mv0b_:

Click to download the PDB-style file with coordinates for d1mv0b_.
(The format of our PDB-style files is described here.)

Timeline for d1mv0b_: