Lineage for d1mt0a_ (1mt0 A:)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 695085Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 695086Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families) (S)
    division into families based on beta-sheet topologies
  5. 697205Family c.37.1.12: ABC transporter ATPase domain-like [52686] (20 proteins)
    there are two additional subdomains inserted into the central core that has a RecA-like topology
  6. 697297Protein Haemolysin B ATP-binding protein [89683] (1 species)
  7. 697298Species Escherichia coli [TaxId:562] [89684] (2 PDB entries)
  8. 697300Domain d1mt0a_: 1mt0 A: [85096]
    complexed with so4

Details for d1mt0a_

PDB Entry: 1mt0 (more details), 2.6 Å

PDB Description: ATP-binding domain of haemolysin B from Escherichia coli
PDB Compounds: (A:) Haemolysin secretion ATP-binding protein

SCOP Domain Sequences for d1mt0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mt0a_ c.37.1.12 (A:) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]}
ditfrnirfrykpdspvildninlsikqgevigivgrsgsgkstltkliqrfyipengqv
lidghdlaladpnwlrrqvgvvlqdnvllnrsiidnislanpgmsvekviyaaklagahd
fiselregyntivgeqgaglsggqrqriaiaralvnnpkilifdeatsaldyesehvimr
nmhkickgrtviiiahrlstvknadriivmekgkiveqgkhkellsepeslysylyqlqs
d

SCOP Domain Coordinates for d1mt0a_:

Click to download the PDB-style file with coordinates for d1mt0a_.
(The format of our PDB-style files is described here.)

Timeline for d1mt0a_: