| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.68: IF3-like [55199] (8 superfamilies) beta-alpha-beta-alpha-beta(2); 2 layers; mixed sheet 1243, strand 4 is antiparallel to the rest |
Superfamily d.68.7: R3H domain [82708] (1 family) ![]() possibly lacks the N-terminal strand of the common fold |
| Family d.68.7.1: R3H domain [82709] (4 proteins) Pfam PF01424; predicted nucleic acid-binding domain |
| Protein SmuBP-2 [82710] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [82711] (1 PDB entry) |
| Domain d1msza_: 1msz A: [79428] |
PDB Entry: 1msz (more details)
SCOPe Domain Sequences for d1msza_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1msza_ d.68.7.1 (A:) SmuBP-2 {Human (Homo sapiens) [TaxId: 9606]}
gvdhframivefmaskkmqlefppslnshdrlrvhqiaeehglrhdssgegkrrfitvsk
ra
Timeline for d1msza_: