Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
Fold d.3: Cysteine proteinases [54000] (1 superfamily) consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn |
Superfamily d.3.1: Cysteine proteinases [54001] (16 families) the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet |
Family d.3.1.1: Papain-like [54002] (25 proteins) |
Protein (Pro)cathepsin S [82566] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [82567] (17 PDB entries) |
Domain d1ms6a_: 1ms6 A: [85080] complexed with bln |
PDB Entry: 1ms6 (more details), 1.9 Å
SCOP Domain Sequences for d1ms6a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ms6a_ d.3.1.1 (A:) (Pro)cathepsin S {Human (Homo sapiens) [TaxId: 9606]} lpdsvdwrekgcvtevkyqgscgacwafsavgaleaqlklktgklvslsaqnlvdcstek ygnkgcnggfmttafqyiidnkgidsdasypykamdqkcqydskyraatcskytelpygr edvlkeavankgpvsvgvdarhpsfflyrsgvyyepsctqnvnhgvlvvgygdlngkeyw lvknswghnfgeegyirmarnkgnhcgiasfpsypei
Timeline for d1ms6a_: