Lineage for d1ms6a_ (1ms6 A:)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 715176Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 715177Superfamily d.3.1: Cysteine proteinases [54001] (16 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 715178Family d.3.1.1: Papain-like [54002] (25 proteins)
  6. 715259Protein (Pro)cathepsin S [82566] (1 species)
  7. 715260Species Human (Homo sapiens) [TaxId:9606] [82567] (17 PDB entries)
  8. 715273Domain d1ms6a_: 1ms6 A: [85080]
    complexed with bln

Details for d1ms6a_

PDB Entry: 1ms6 (more details), 1.9 Å

PDB Description: Dipeptide Nitrile Inhibitor Bound to Cathepsin S.
PDB Compounds: (A:) cathepsin S

SCOP Domain Sequences for d1ms6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ms6a_ d.3.1.1 (A:) (Pro)cathepsin S {Human (Homo sapiens) [TaxId: 9606]}
lpdsvdwrekgcvtevkyqgscgacwafsavgaleaqlklktgklvslsaqnlvdcstek
ygnkgcnggfmttafqyiidnkgidsdasypykamdqkcqydskyraatcskytelpygr
edvlkeavankgpvsvgvdarhpsfflyrsgvyyepsctqnvnhgvlvvgygdlngkeyw
lvknswghnfgeegyirmarnkgnhcgiasfpsypei

SCOP Domain Coordinates for d1ms6a_:

Click to download the PDB-style file with coordinates for d1ms6a_.
(The format of our PDB-style files is described here.)

Timeline for d1ms6a_: