Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily) duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets |
Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families) |
Family d.157.1.1: Zn metallo-beta-lactamase [56282] (2 proteins) |
Protein Zn metallo-beta-lactamase [56283] (12 species) |
Species Bacillus cereus [TaxId:1396] [56284] (27 PDB entries) Uniprot P04190 31-257 |
Domain d1mqoa_: 1mqo A: [103846] complexed with cd, cit |
PDB Entry: 1mqo (more details), 1.35 Å
SCOPe Domain Sequences for d1mqoa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mqoa_ d.157.1.1 (A:) Zn metallo-beta-lactamase {Bacillus cereus [TaxId: 1396]} tviknetgtisisqlnknvwvhtelgsfngeavpsnglvlntskglvlvdsswddkltke liemvekkfqkrvtdviithahadriggiktlkergikahstaltaelakkngyeeplgd lqtvtnlkfgnmkvetfypgkghtednivvwlpqynilvggclvkstsakdlgnvadayv newstsienvlkryrninavvpghgevgdkglllhtldllk
Timeline for d1mqoa_: