Lineage for d1mqkl_ (1mqk L:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2352461Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2353665Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species)
    VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 2354271Species Mouse (Mus musculus), cluster 4 [TaxId:10090] [88531] (231 PDB entries)
    Uniprot P01645 1-106 # 95% sequense identity; KV5L_MOUSE Ig kappa chain V-V region HP 93G7 ! SQ NA # natural chimera; best hits are: Uniprot P01637 (Ig kappa chain V-V region T1) and Uniprot P01837 (Ig kappa chain C region) ! SQ NA # humanized antibody ! SQ NA # part of Fab 28 against HIV-1 RT ! Uniprot P01642 21-115 # ! KV5I_MOUSE Ig kappa chain V-V region L7 precursor
  8. 2354274Domain d1mqkl_: 1mqk L: [85054]
    Other proteins in same PDB: d1mqkh_
    part of Fv against Paracoccus denitrificans cytochrome c oxidase

Details for d1mqkl_

PDB Entry: 1mqk (more details), 1.28 Å

PDB Description: crystal structure of the unliganded fv-fragment of the anti-cytochrome c oxidase antibody 7e2
PDB Compounds: (L:) antibody 7E2 FV fragment, light chain

SCOPe Domain Sequences for d1mqkl_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mqkl_ b.1.1.1 (L:) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]}
dieltqtpvslsasvgetvtitcraseniysylawyqqkqgkspqflvynaktlgegvps
rfsgsgsgtqfslkinsllpedfgsyycqhhygtppltfgggtkleikr

SCOPe Domain Coordinates for d1mqkl_:

Click to download the PDB-style file with coordinates for d1mqkl_.
(The format of our PDB-style files is described here.)

Timeline for d1mqkl_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1mqkh_