Lineage for d1mq1a_ (1mq1 A:)
- Root: SCOPe 2.03
Class a: All alpha proteins [46456] (284 folds) 
Fold a.39: EF Hand-like [47472] (4 superfamilies)
core: 4 helices; array of 2 hairpins, openedSuperfamily a.39.1: EF-hand [47473] (12 families) 
Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
Family a.39.1.2: S100 proteins [47478] (2 proteins)
dimer: subunits are made of two EF-handsProtein Calcyclin (S100) [47479] (17 species) 
Species Human (Homo sapiens), s100b [TaxId:9606] [47483] (6 PDB entries) 
Domain d1mq1a_: 1mq1 A: [79392]
complex with high-affinity target peptide trtk-12, chains C and D
Details for d1mq1a_
PDB Entry: 1mq1 (more details)
PDB Description: ca2+-s100b-trtk-12 complex
PDB Compounds: (A:) S-100 protein, beta chainSCOPe Domain Sequences for d1mq1a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mq1a_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100b [TaxId: 9606]}
selekamvalidvfhqysgregdkhklkkselkelinnelshfleeikeqevvdkvmetl
dndgdgecdfqefmafvamvttacheffehe
SCOPe Domain Coordinates for d1mq1a_:
Click to download the PDB-style file with coordinates for d1mq1a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1mq1a_:
- d1mq1a_ first appeared in SCOP 1.63
- d1mq1a_ appears in SCOPe 2.02
- d1mq1a_ appears in SCOPe 2.04
- d1mq1a_ appears in the current release, SCOPe 2.08
View in 3D
