Lineage for d1mq1a_ (1mq1 A:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 914068Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 914069Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 914095Family a.39.1.2: S100 proteins [47478] (2 proteins)
    dimer: subunits are made of two EF-hands
  6. 914096Protein Calcyclin (S100) [47479] (17 species)
  7. 914230Species Human (Homo sapiens), s100b [TaxId:9606] [47483] (6 PDB entries)
  8. 914240Domain d1mq1a_: 1mq1 A: [79392]
    complex with high-affinity target peptide trtk-12, chains C and D

Details for d1mq1a_

PDB Entry: 1mq1 (more details)

PDB Description: ca2+-s100b-trtk-12 complex
PDB Compounds: (A:) S-100 protein, beta chain

SCOPe Domain Sequences for d1mq1a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mq1a_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100b [TaxId: 9606]}
selekamvalidvfhqysgregdkhklkkselkelinnelshfleeikeqevvdkvmetl
dndgdgecdfqefmafvamvttacheffehe

SCOPe Domain Coordinates for d1mq1a_:

Click to download the PDB-style file with coordinates for d1mq1a_.
(The format of our PDB-style files is described here.)

Timeline for d1mq1a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1mq1b_