Lineage for d1mq0a_ (1mq0 A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2525733Fold c.97: Cytidine deaminase-like [53926] (2 superfamilies)
    core: alpha-beta(2)-(alpha-beta)2; 3 layers (a/b/a); mixed beta-sheet of 4 strands, order 2134; strand 1 is antiparallel to the rest
  4. 2525734Superfamily c.97.1: Cytidine deaminase-like [53927] (7 families) (S)
    contains extra C-terminal strand 5, order 21345
  5. 2525735Family c.97.1.1: Cytidine deaminase [53928] (4 proteins)
    strand 5 is antiparallel to strand 4
  6. 2525739Protein mono-domain cytidine deaminase [75327] (5 species)
  7. 2525759Species Human (Homo sapiens) [TaxId:9606] [102711] (1 PDB entry)
  8. 2525760Domain d1mq0a_: 1mq0 A: [91389]
    complexed with brd, zn

Details for d1mq0a_

PDB Entry: 1mq0 (more details), 2.4 Å

PDB Description: crystal structure of human cytidine deaminase
PDB Compounds: (A:) Cytidine deaminase

SCOPe Domain Sequences for d1mq0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mq0a_ c.97.1.1 (A:) mono-domain cytidine deaminase {Human (Homo sapiens) [TaxId: 9606]}
ecvqqllvcsqeakqsaycpyshfpvgaalltqegrifkgcnienacyplgicaertaiq
kavsegykdfraiaiasdmqddfispcgacrqvmrefgtnwpvymtkpdgtyivmtvqel
lpssfgpedl

SCOPe Domain Coordinates for d1mq0a_:

Click to download the PDB-style file with coordinates for d1mq0a_.
(The format of our PDB-style files is described here.)

Timeline for d1mq0a_: